Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Gabra5 Rabbit Polyclonal Antibody

SKU: orb573674

Description

Gabra5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Gabra5. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to the middle region of mouse GABRA5. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to the middle region of mouse GABRA5
TargetGabra5
Protein SequenceSynthetic peptide located within the following region: WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK
Molecular Weight52 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

A230018I05Rik

Similar Products

  • GABRA5 Rabbit Polyclonal Antibody [orb575342]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GABAA Receptor α5 Antibody [orb613673]

    ELISA,  IHC,  WB

    Bovine, Canine, Gallus, Human, Primate, Zebrafish

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GABRA5 Rabbit Polyclonal Antibody [orb575341]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GABRA5 Rabbit Polyclonal Antibody [orb101717]

    WB

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GABRA5 Rabbit Polyclonal Antibody [orb704428]

    WB

    Equine, Gallus, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Gabra5 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Full length 52 kDa Gabra5 is cleaved to a mature 48 kDa form, and the protein is also subject to N-linked glycosylation.

Gabra5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Gabra5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Gabra5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1.0 ug/ml.

Gabra5 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Gabra5 Rabbit Polyclonal Antibody

WB Suggested Anti-Gabra5 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_795916

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Gabra5 Rabbit Polyclonal Antibody (orb573674)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry