Gabra5 Rabbit Polyclonal Antibody

• Catalog Number: orb573674
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gabra5
• Target: Gabra5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to the middle region of mouse GABRA5
• Protein Sequence: Synthetic peptide located within the following region: WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK
• UniProt ID: Q8BHJ7
• MW: 52 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A230018I05Rik
• Note: For research use only
• NCBI: NP_795916

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Full length 52 kDa Gabra5 is cleaved to a mature 48 kDa form, and the protein is also subject to N-linked glycosylation.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1.0 ug/ml.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-Gabra5 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse liver.