GABRA3 Rabbit Polyclonal Antibody

• Catalog Number: orb575340
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GABRA3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABRA3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55 kDa
• Target: GABRA3
• UniProt ID: P34903
• Protein Sequence: Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
• NCBI: NP_000799
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.

Mouse bulbus

WB Suggested Anti-GABRA3 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

WB Suggested Anti-GABRA3 Antibody Titration: 3 ug/ml, Positive Control: HeLa, A549.