You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589316 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABBR1 |
Target | GABBR1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABBR1 |
Protein Sequence | Synthetic peptide located within the following region: RGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSEL |
UniProt ID | Q59HG8 |
MW | 88 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GB1, GPRC3A, GABABR1, GABBR1-3 |
Note | For research use only |
NCBI | NP_001461.1 |
Sample Tissue: Human DLD1 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Mouse | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Guinea pig, Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |