GABBR1 Rabbit Polyclonal Antibody

SKU: orb589316

Description

Rabbit polyclonal antibody to GABBR1

Research Area

Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Rat
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABBR1
• Target: GABBR1
• Protein Sequence: Synthetic peptide located within the following region: RGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSEL
• Molecular Weight: 88 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GB1, GPRC3A, GABABR1, GABBR1-3

Sample Tissue: Human DLD1 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

GABBR1

UniProt

Q59HG8

RefSeq (Protein):NP_001461.1