GABARAPL1 Rabbit Polyclonal Antibody

• Catalog Number: orb582741
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GABARAPL1
• Target: GABARAPL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1
• Protein Sequence: Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
• UniProt ID: Q9H0R8
• MW: 14 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ATG8, GEC1, APG8L, ATG8B, ATG8L, APG8-LIKE
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_113600

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be modified by lipidation.

Anti-GABARAPL1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Sample Type: Hela Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Human Brain lysate tissue at an antibody concentration of 5.0 ug/ml using anti-GABARAPL1 antibody (orb582741).

WB Suggested Anti-GABARAPL1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. GABARAPL1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.