You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581326 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABARAP |
Target | GABARAP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAP |
Protein Sequence | Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
UniProt ID | O95166 |
MW | 14kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MM46, ATG8A, GABARAP-a |
Note | For research use only |
NCBI | NP_009209 |
Autophagy is induced by starvation Sample: Newborn M. Sexta larvae, Lanes: Newborn larvae were treated for 0, 0.5, 1, 2, 3, 4, and 5 h, Protein Loaded: 100 ug per lane.
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.
Rabbit Anti-GABARAP Antibody, Catalog Number: orb581326, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. GABARAP is supported by BioGPS gene expression data to be expressed in HT1080.
IF, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Biotin |