You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330167 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FZD9 |
| Target | FZD9 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9 |
| Protein Sequence | Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
| UniProt ID | O00144 |
| MW | 65kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FZD3 antibody, anti CD349 antibody |
| Research Area | Cell Biology, Epigenetics & Chromatin, Neuroscienc Read more... |
| Note | For research use only |
| NCBI | NP_003499 |
| Expiration Date | 12 months from date of receipt. |

Rabbit Anti-FZD9 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-FZD9 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
ELISA, IF, WB | |
Human, Monkey, Mouse | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Human, Monkey, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review