FZD7 Rabbit Polyclonal Antibody

• Catalog Number: orb330165
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FZD7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: FZD7
• UniProt ID: O75084
• Protein Sequence: Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
• NCBI: NP_003498
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FzE3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 0.2 ug/mL.

Rabbit Anti-FZD7 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-FZD7 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.