You have no items in your shopping cart.
FZD7 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7 |
| Target | FZD7 |
| Protein Sequence | Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
| Molecular Weight | 63kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Frizzled 7 Rabbit Polyclonal Antibody [orb5256]
FC, WB
Bovine, Canine, Gallus, Guinea pig, Porcine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlFZD7 Rabbit Polyclonal Antibody [orb627130]
ELISA, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgFrizzled-7 (Y87) polyclonal antibody [orb643744]
IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
25 μl, 200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 0.2 ug/mL.

Rabbit Anti-FZD7 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-FZD7 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
FZD7 Rabbit Polyclonal Antibody (orb330165)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








