FYN antibody

• Catalog Number: orb330812
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FYN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: FYN
• UniProt ID: P06241
• Protein Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
• NCBI: NP_694593
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC45350 antibody, anti SLK antibody, anti SY
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HEK293T tissue using FYN antibody

Western blot analysis of human heart tissue using FYN antibody

Western blot analysis of human Placenta tissue using FYN antibody

Western blot analysis of human Fetal Lung tissue using FYN antibody