You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579814 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FXYD1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 10kDa |
Target | FXYD1 |
UniProt ID | O00168 |
Protein Sequence | Synthetic peptide located within the following region: ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG |
NCBI | NP_005022 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PLM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 3 ug/ml.
WB Suggested Anti-FXYD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |