FUBP1 Rabbit Polyclonal Antibody

• Catalog Number: orb576395
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FUBP1
• Target: FUBP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUBP1
• Protein Sequence: Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM
• UniProt ID: Q96AE4
• MW: 68kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FBP, FUBP, hDH V
• Research Area: Cancer Biology, Epigenetics & Chromatin, Molecular
• Note: For research use only
• NCBI: NP_003893
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-FUBP1 Antibody, Catalog Number: orb576395, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FUBP1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. FUBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.