You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582204 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FSCN3 |
| Target | FSCN3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FSCN3 |
| Protein Sequence | Synthetic peptide located within the following region: WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE |
| UniProt ID | Q9NQT6 |
| MW | 55kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_065102 |

WB Suggested Anti-FSCN3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Canine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Canine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy3 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review