You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585777 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FPR1 |
Target | FPR1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: VACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGL |
UniProt ID | P21462 |
MW | 38kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FPR, FMLP |
Note | For research use only |
NCBI | NP_002020 |
Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
WB Suggested Anti-FPR1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
WB | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |