You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585645 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FPGS |
| Target | FPGS |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT |
| UniProt ID | Q5JU19 |
| MW | 59kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_001018088 |

Rabbit Anti-FPGS Antibody, Catalog Number: orb585645, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in mitochondria, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FPGS Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
ICC, IF | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
PE |
ELISA, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review