You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577275 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXQ1 |
Target | FOXQ1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXQ1 |
Protein Sequence | Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS |
UniProt ID | Q9C009 |
MW | 41kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HFH1 |
Note | For research use only |
NCBI | NP_150285 |
WB Suggested Anti-FOXQ1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |