You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574270 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FOXP1 |
| Target | FOXP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1 |
| Protein Sequence | Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI |
| UniProt ID | Q9H334 |
| MW | 75kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MFH, QRF1, 12CC4, hFKH1B, HSPC215 |
| Research Area | Cancer Biology, Epigenetics & Chromatin, Molecular Read more... |
| Note | For research use only |
| NCBI | NP_116071 |

Human kidney

Human Lung

WB Suggested Anti-FOXP1 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC | |
Bovine, Canine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review