FOXP1 Rabbit Polyclonal Antibody

• Catalog Number: orb574270
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXP1
• Target: FOXP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1
• Protein Sequence: Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
• UniProt ID: Q9H334
• MW: 75kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MFH, QRF1, 12CC4, hFKH1B, HSPC215
• Research Area: Cancer Biology, Epigenetics & Chromatin, Molecular
• Note: For research use only
• NCBI: NP_116071

Human kidney

Human Lung

WB Suggested Anti-FOXP1 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate.