FOXM1 Rabbit Polyclonal Antibody

• Catalog Number: orb573682
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXM1
• Target: FOXM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXM1
• Protein Sequence: Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
• UniProt ID: Q08050
• MW: 88kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, F
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_973731

Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml, Positive Control: THP-1 cell lysate.