You have no items in your shopping cart.
FOXJ3 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FOXJ3 |
| Target | FOXJ3 |
| Protein Sequence | Synthetic peptide located within the following region: IPQALSTPGTTMAGHHRAMNQQHMMPSQAFQMRRSLPPDDIQDDFDWDSI |
| Molecular Weight | 69kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FoxJ3 rabbit pAb Antibody [orb768143]
ELISA, IF, IHC
Human, Mouse
Polyclonal
Unconjugated
100 μl, 50 μlFoxj3 Rabbit Polyclonal Antibody [orb573893]
WB
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlFOXJ3 Rabbit Polyclonal Antibody [orb574118]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rabbit Anti-FOXJ3 antibody, Catalog Number: orb576984, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-FOXJ3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. FOXJ3 is supported by BioGPS gene expression data to be expressed in HEK293T.
Documents Download
Request a Document
Protocol Information
FOXJ3 Rabbit Polyclonal Antibody (orb576984)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




