Foxf1a Rabbit Polyclonal Antibody

• Catalog Number: orb324679
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Foxf1
• Target: Foxf1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Foxf1a
• Protein Sequence: Synthetic peptide located within the following region: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA
• UniProt ID: Q61080
• MW: 38kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AI450827 antibody, anti FREAC1 antibody, anti
• Note: For research use only
• NCBI: NP_034556
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse E 18.5 Gut, Dilution: 1:1000.

WB Suggested Anti-Foxf1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Heart.