FOXC1 Rabbit Polyclonal Antibody

• Catalog Number: orb329956
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: FOXC1
• UniProt ID: Q12948
• Protein Sequence: Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI
• NCBI: NP_001444
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARA antibody, anti FKHL7 antibody, anti FREAC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Colon, myenteric plexus.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/mL.

WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.