FOXC1 Rabbit Polyclonal Antibody

SKU: orb329956

Description

Rabbit polyclonal antibody to FOXC1

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXC1
• Target: FOXC1
• Protein Sequence: Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI
• Molecular Weight: 57kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ARA antibody, anti FKHL7 antibody, anti FREAC3 antibody, anti IGDA antibody, anti IHG1 antibody, anti IRID1 antibody, anti RIEG3 antibody, anti FREAC-3 antibody

Colon, myenteric plexus.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/mL.

WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.

Quick Database Links

Gene Symbol

FOXC1

UniProt

Q12948

RefSeq (Protein):NP_001444