FOXA1 Rabbit Polyclonal Antibody

SKU: orb574302

Description

Rabbit polyclonal antibody to FOXA1

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1
• Target: FOXA1
• Protein Sequence: Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
• Molecular Weight: 49kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HNF3A, TCF3A

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-FOXA1 antibody, Catalog Number: orb574302, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FOXA1 Antibody, Positive Control: Lane 1: 20 ug MCF7 cell lysates, Lane 2: 20 ug MCF7 cell lysates, Lane 3: 20 ug MCF7 cell lysate, s Lane 4: 20 ug MCF7 cell lysate, s Lane 5: 20 ug MCF7 with FoxA1 knockdown Lane 6: 20 ug MCF7 with FoxA1 knockdown, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

Quick Database Links

Gene Symbol

FOXA1

UniProt

Q0JTB6

RefSeq (Protein):NP_004487