Cart summary

You have no items in your shopping cart.

FOXA1 Rabbit Polyclonal Antibody

SKU: orb583752

Description

Rabbit polyclonal antibody to FOXA1

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Mouse, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
TargetFOXA1
Protein SequenceSynthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HNF3A, TCF3A

Similar Products

  • FOXA1 Rabbit Polyclonal Antibody [orb574302]

    IHC,  WB

    Bovine, Canine, Guinea pig, Rat, Yeast, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNF-3α/β/γ (Acetyl Lys264/253/211) rabbit pAb Antibody [orb763976]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HNF-3α/β/γ rabbit pAb Antibody [orb766929]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • FOXA1 Antibody [orb675242]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • FOXA1 Rabbit Polyclonal Antibody [orb627101]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FOXA1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

FOXA1 Rabbit Polyclonal Antibody

FOXA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb583752 with 1:200 dilution. Western blot was performed using orb583752 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FOXA1 IP with orb583752 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

FOXA1 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004487

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FOXA1 Rabbit Polyclonal Antibody (orb583752)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry