FOSL1 Rabbit Polyclonal Antibody

• Catalog Number: orb329599
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOSL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOSL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: FOSL1
• UniProt ID: P15407
• Protein Sequence: Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
• NCBI: NP_005429
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FRA1 antibody, anti fra-1 antibody, anti FRA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Human Skin

Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0 ug/mL using anti-FOSL1 antibody (orb329599).

Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-FOSL1 Antibody, Catalog Number: orb329599, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.