Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FOLR1 Rabbit Polyclonal Antibody

SKU: orb578055

Description

FOLR1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FOLR1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human FOLR1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOLR1
TargetFOLR1
Protein SequenceSynthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
Molecular Weight30 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FBP, FOLR, NCFTD, FRalpha

Similar Products

  • FOLR2 Rabbit Polyclonal Antibody [orb317614]

    IF,  IHC-Fr,  IHC-P,  WB

    Equine, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • FOLR1 Antibody (N-term) [orb28615]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Folate Receptor alpha Rabbit Polyclonal Antibody [orb183496]

    IF,  IHC-Fr,  IHC-P

    Bovine, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • FOLR1 Rabbit Polyclonal Antibody [orb627099]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FR-α rabbit pAb Antibody [orb768223]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FOLR1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. FOLR1 is modified via glycosylation and processed to a mature form.

FOLR1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

FOLR1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 5 ug/ml.

FOLR1 Rabbit Polyclonal Antibody

Sample Type: PANC1 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

FOLR1 Rabbit Polyclonal Antibody

Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

FOLR1 Rabbit Polyclonal Antibody

Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane in bile ducts not in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

FOLR1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOLR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. FOLR1 is supported by BioGPS gene expression data to be expressed in PANC1.

FOLR1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOLR1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000793

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FOLR1 Rabbit Polyclonal Antibody (orb578055)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry