Cart summary

You have no items in your shopping cart.

FLVCR1 Rabbit Polyclonal Antibody (HRP)

FLVCR1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2105768

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2105768
CategoryAntibodies
DescriptionFLVCR1 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
Protein SequenceSynthetic peptide located within the following region: GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT
UniProt IDB2RXV4
MW60kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFLVCR, Mfsd7, Mfsd7b, 9630055N22Rik
NoteFor research use only
NCBINP_001074728
Expiration Date12 months from date of receipt.
  • FLVCR Rabbit Polyclonal Antibody (HRP) [orb470457]

    IHC-Fr,  IHC-P,  WB

    Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl