Cart summary

You have no items in your shopping cart.

FLNC Rabbit Polyclonal Antibody

SKU: orb326498

Description

Rabbit polyclonal antibody to FLNC

Research Area

Cardiovascular Disease, Epigenetics

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FLNC
TargetFLNC
Protein SequenceSynthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
Molecular Weight296kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ABP-280 antibody, anti ABP280A antibody, anti ABPA antibody, anti ABPL antibody, anti FLJ10186 antibody, anti FLN2 antibody

Similar Products

  • FLNC Rabbit Polyclonal Antibody [orb156880]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Primate, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • FLNC Antibody [orb666695]

    IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl
  • Phospho-FLNC (Ser2233) Rabbit Polyclonal Antibody [orb156898]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Porcine, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • FLNC Rabbit Polyclonal Antibody [orb1292534]

    ELISA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FLNC polyclonal antibody [orb647807]

    IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FLNC Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

FLNC Rabbit Polyclonal Antibody

WB Suggested Anti-FLNC Antibody, Titration: 1.0 ug/mL, Positive Control: HepG2 Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FLNC Rabbit Polyclonal Antibody (orb326498)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry