FILIP1L Rabbit Polyclonal Antibody

• Catalog Number: orb325733
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FILIP1L
• Target: FILIP1L
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FILIP1L
• Protein Sequence: Synthetic peptide located within the following region: KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY
• UniProt ID: Q4L180
• MW: 102kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DOC-1 antibody, anti DOC1 antibody, anti GIP9
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_055705

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide sequence is present in isoforms of 130 kDa, 102 kDa, 81 and 29 kDa.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-FILIP1L Antibody Titration: 0.2-1 ug/mL, Positive Control: NCI-H226 cell lysate.