Cart summary

You have no items in your shopping cart.

FILIP1L Rabbit Polyclonal Antibody

SKU: orb325733

Description

Rabbit polyclonal antibody to FILIP1L

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FILIP1L
TargetFILIP1L
Protein SequenceSynthetic peptide located within the following region: KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY
Molecular Weight102kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DOC-1 antibody, anti DOC1 antibody, anti GIP90 antibody, anti GIP130 antibody, anti GIP130a antibody, anti GIP130b antibody, anti GIP130c antibody

Similar Products

  • FILIP1L Rabbit Polyclonal Antibody (HRP) [orb2109398]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • FILIP1L Rabbit Polyclonal Antibody (FITC) [orb2109399]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • FILIP1L Rabbit Polyclonal Antibody (Biotin) [orb2109400]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FILIP1L Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide sequence is present in isoforms of 130 kDa, 102 kDa, 81 and 29 kDa.

FILIP1L Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/mL.

FILIP1L Rabbit Polyclonal Antibody

WB Suggested Anti-FILIP1L Antibody Titration: 0.2-1 ug/mL, Positive Control: NCI-H226 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055705

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FILIP1L Rabbit Polyclonal Antibody (orb325733)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry