Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FILIP1L Rabbit Polyclonal Antibody

SKU: orb325733

Description

FILIP1L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FILIP1L. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human FILIP1L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FILIP1L
TargetFILIP1L
Protein SequenceSynthetic peptide located within the following region: KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY
Molecular Weight102kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DOC-1 antibody, anti DOC1 antibody, anti GIP90 antibody, anti GIP130 antibody, anti GIP130a antibody, anti GIP130b antibody, anti GIP130c antibody

Similar Products

  • FILIP1L Rabbit Polyclonal Antibody (Biotin) [orb2109400]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • FILIP1L Rabbit Polyclonal Antibody (HRP) [orb2109398]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • FILIP1L Rabbit Polyclonal Antibody (FITC) [orb2109399]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • FILIP1L Peptide - middle region [orb2013893]

    WB

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055705

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry