You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325733 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FILIP1L |
| Target | FILIP1L |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FILIP1L |
| Protein Sequence | Synthetic peptide located within the following region: KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY |
| UniProt ID | Q4L180 |
| MW | 102kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti DOC-1 antibody, anti DOC1 antibody, anti GIP9 Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_055705 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide sequence is present in isoforms of 130 kDa, 102 kDa, 81 and 29 kDa.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-FILIP1L Antibody Titration: 0.2-1 ug/mL, Positive Control: NCI-H226 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review