FGA antibody

• Catalog Number: orb324964
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FGA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Human, Mouse, Porcine, Rat, Sheep
• Reactivity: Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: FGA
• UniProt ID: Q4QQH7
• Protein Sequence: Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
• NCBI: NP_068657
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Fib2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Jurkat cell lysate tissue using FGA antibody

Immunohistochemical staining of human Skin tissue using FGA antibody