You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324964 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FGA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Mouse, Porcine, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FGA |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71kDa |
Target | FGA |
UniProt ID | Q4QQH7 |
Protein Sequence | Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS |
NCBI | NP_068657 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Fib2 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-FGA Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-FGA Antibody Titration: 5.0 ug/mL, Positive Control: Jurkat cell lysate.
IHC-P, PLA, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Mouse | |
Human, Rat | |
Rabbit | |
Polyclonal | |
FITC |