You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585371 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to O3FAR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | FFAR4 |
UniProt ID | Q5NUL3 |
Protein Sequence | Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM |
NCBI | NP_079355 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GT01, PGR4, BMIQ10, GPR120, GPR129, O3FAR1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-O3FAR1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
ICC, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |