You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586607 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FEZ2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rat |
Reactivity | Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat FEZ2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41 kDa |
Target | FEZ2 |
UniProt ID | P97578 |
Protein Sequence | Synthetic peptide located within the following region: VENSFISALIEVQNKQKEHKETAKKKKKLKNGSSQNGRNERSHMPGTRFS |
NCBI | NP_446052.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Zrp Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Rat Pancreas, Antibody dilution: 1.0 ug/ml.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |