You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582185 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FEM1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FEM1B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 69kDa |
Target | FEM1B |
UniProt ID | Q9UK73 |
Protein Sequence | Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE |
NCBI | NP_056137 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | F1AA, F1A-ALPHA, FEM1-beta Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1: 30 ug HEK293T cell lysate, 2: 30 ug 3FLAG-hFEM1B transfected HEK293T cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: FEM1B, FEM1B is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
WB Suggested Anti-FEM1B Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FEM1B is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |