FEM1B Rabbit Polyclonal Antibody

SKU: orb582185

Description

Rabbit polyclonal antibody to FEM1B

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FEM1B
• Target: FEM1B
• Protein Sequence: Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE
• Molecular Weight: 69kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

F1AA, F1A-ALPHA, FEM1-beta

Lanes: 1: 30 ug HEK293T cell lysate, 2: 30 ug 3FLAG-hFEM1B transfected HEK293T cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: FEM1B, FEM1B is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-FEM1B Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FEM1B is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

FEM1B

UniProt

Q9UK73

RefSeq (Protein):NP_056137