FECH Rabbit Polyclonal Antibody

• Catalog Number: orb578164
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FECH
• Target: FECH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FECH
• Protein Sequence: Synthetic peptide located within the following region: KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW
• UniProt ID: P22830
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EPP, FCE, EPP1
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_000131

Lanes: 1. 6 ug mouse brain mitochondria extract 2. 6 ug mouse brain mitochondria extract 3. 6 ug mouse brain mitochondria extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: FECH.

WB Suggested Anti-FECH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. FECH is supported by BioGPS gene expression data to be expressed in MCF7.