You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579778 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FCGRT |
Target | FCGRT |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT |
Protein Sequence | Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE |
UniProt ID | P55899 |
MW | 40kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FCRN, alpha-chain |
Note | For research use only |
NCBI | NP_004098 |
Rabbit Anti-FCGRT Antibody, Catalog Number: orb579778, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane and cytoplasmic in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FCGRT Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. FCGRT is supported by BioGPS gene expression data to be expressed in HepG2.
FC, WB | |
Canine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Canine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
BF350 |
FC | |
Canine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
APC |
FC | |
Canine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
PE |