FCGR3A/CD16A Antibody

SKU: orb1535797

Description

FCGR3A/CD16A Antibody

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC (1:50 - 1:200), IHC-P (1:100), WB (1:500 - 1:2000)
• Reactivity: Human, Mouse, Rat
• Application Notes:
  Further information: The predicted MW is 29kDa, while the observed MW by Western blot was 27kDa.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_001121067.1). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
• Target: FCGR3A / CD16A
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 0.926 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FCGR3A, CD16A, CD16a antigen, CD16, FcgammaRIIIA, FCR-10, FCRIII, Fc gamma receptor III-A, Fc-gamma RIII, Fc-gamma RIII-alpha, FCG3, IGFR3, Fc- gamma riii, Fc-gamma receptor IIIb (CD16), Fc-gamma RIIIa, FCGR3, FCRIIIA, Neutrophil-specific antigen NA, Igg fc receptor iii-1, IgG Fc receptor III-2, Igg fc receptors iii-1, FCGRIII

Quick Database Links

Gene Symbol

FCGR3A / CD16A