Cart summary

You have no items in your shopping cart.

FBXW12 Rabbit Polyclonal Antibody (FITC)

FBXW12 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088321

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088321
CategoryAntibodies
DescriptionFBXW12 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human FBXW12
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW48kDa
UniProt IDQ494Y9
Protein SequenceSynthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA
NCBINP_001153401
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFBW12, FBXO12, FBXO35
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.