You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331378 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FBXO44 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Guinea pig, Human, Mouse, Porcine, Rat |
Reactivity | Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FBXO44 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | FBXO44 |
UniProt ID | Q9H4M3 |
Protein Sequence | Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG |
NCBI | NP_149438 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FBG3 antibody, anti FBX30 antibody, anti FBX6 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal heart tissue using FBXO44 antibody
Filter by Rating