You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330285 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FBXO4 |
| Target | FBXO4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FBXO4 |
| Protein Sequence | Synthetic peptide located within the following region: KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRA |
| UniProt ID | Q9UKT5 |
| MW | 44kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti DKFZp547N213 antibody, anti FBX4 antibody, an Read more... |
| Research Area | Protein Biochemistry |
| Note | For research use only |
| NCBI | NP_036308 |

WB Suggested Anti-FBXO4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: OVCAR-3 cell lysate, FBXO4 is supported by BioGPS gene expression data to be expressed in OVCAR3.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
ELISA, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review