Cart summary

You have no items in your shopping cart.

FBXO27 Rabbit Polyclonal Antibody (Biotin)

FBXO27 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2100031

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2100031
CategoryAntibodies
DescriptionFBXO27 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FBXO27
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW31kDa
UniProt IDQ8NI29
Protein SequenceSynthetic peptide located within the following region: LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG
NCBINP_849142
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFBG5, Fbx27
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.