FBXO11 Rabbit Polyclonal Antibody

• Catalog Number: orb578790
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FBXO11
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO11
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 94kDa
• Target: FBXO11
• UniProt ID: Q6DF73
• Protein Sequence: Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ
• NCBI: NP_079409
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: UBR6, VIT1, FBX11, PRMT9, IDDFBA, UG063H01
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-FBXO11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. FBXO11 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.