You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578730 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FBXL7 |
| Target | FBXL7 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL7 |
| Protein Sequence | Synthetic peptide located within the following region: IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD |
| UniProt ID | Q9UJT9 |
| MW | 54kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FBL6, FBL7 |
| Research Area | Protein Biochemistry |
| Note | For research use only |
| NCBI | NP_036436 |

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Ovary tumor (T-OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-FBXL7 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review