FBXL7 Rabbit Polyclonal Antibody

SKU: orb578730

Description

Rabbit polyclonal antibody to FBXL7

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL7
• Target: FBXL7
• Protein Sequence: Synthetic peptide located within the following region: IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
• Molecular Weight: 54kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FBL6, FBL7

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Ovary tumor (T-OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-FBXL7 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

FBXL7

UniProt

Q9UJT9

RefSeq (Protein):NP_036436