FAU Rabbit Polyclonal Antibody

• Catalog Number: orb582400
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAU
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAU
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 8 kDa
• Target: FAU
• UniProt ID: P62861
• Protein Sequence: Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
• NCBI: NP_001988
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. FAU is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FAU is supported by BioGPS gene expression data to be expressed in MCF7.

Rabbit Anti-FAU Antibody, Catalog Number: orb582400, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-FAU Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FAU is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-FAU antibody Titration: 1 ug/ml, Sample Type: Human liver.