Cart summary

You have no items in your shopping cart.

FASTKD5 Rabbit Polyclonal Antibody (FITC)

FASTKD5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2083755

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2083755
CategoryAntibodies
DescriptionFASTKD5 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD5
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW84kDa
UniProt IDQ7L8L6
Protein SequenceSynthetic peptide located within the following region: KSLKLVRYRAFCSPSAFGAVRSVSYWNVSSTQHGGQDPPEHISLCHSAKK
NCBINP_068598
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesdJ1187M17.5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.