Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FANCL Rabbit Polyclonal Antibody

SKU: orb330840

Description

FANCL Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FANCL. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human FANCL. This antibody reacts with Human samples and is predicted to react with Canine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityCanine, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FANCL
TargetFANCL
Protein SequenceSynthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
Molecular Weight43 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FAAP43 antibody, anti FLJ10335 antibody, anti PHF9 antibody, anti POG antibody

Similar Products

  • FANCL Rabbit Polyclonal Antibody [orb626946]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FANCL rabbit pAb Antibody [orb772497]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • FANCL Antibody [orb1311993]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • FANCL Antibody(C-term) [orb1932273]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • FANCL Rabbit Polyclonal Antibody [orb626947]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FANCL Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

FANCL Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

FANCL Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml.

FANCL Rabbit Polyclonal Antibody

Lanes: Lane 1: 7 ug HEK293 cytoplasmic lysate, 2: 7 ug HEK293 nuclei lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:3000, Gene Name: FANCL.

FANCL Rabbit Polyclonal Antibody

Rabbit Anti-FANCL Antibody, Catalog Number: orb330840, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and nuclear in in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

FANCL Rabbit Polyclonal Antibody

WB Suggested Anti-FANCL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FANCL Rabbit Polyclonal Antibody (orb330840)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry