Cart summary

You have no items in your shopping cart.

FAM92B Rabbit Polyclonal Antibody (HRP)

FAM92B Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2104352

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104352
CategoryAntibodies
DescriptionFAM92B Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FAM92B
Protein SequenceSynthetic peptide located within the following region: FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
UniProt IDQ6ZTR7
MW35kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFAM92B
NoteFor research use only
NCBINP_940893