FAM83E Rabbit Polyclonal Antibody

• Catalog Number: orb583414
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM83E
• Target: FAM83E
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM83E
• Protein Sequence: Synthetic peptide located within the following region: RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM
• UniProt ID: Q2M2I3
• MW: 52kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FLJ20200, MGC138175, MGC138177
• Note: For research use only
• NCBI: NP_060178

WB Suggested Anti-FAM83E Antibody Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate. FAM83E is supported by BioGPS gene expression data to be expressed in NCIH226.