You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587391 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FAM83A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen for Anti-FAM83A antibody is: synthetic peptide directed towards the C-terminal region of Human FA83A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32 kDa |
Target | FAM83A |
UniProt ID | Q86UY5 |
Protein Sequence | Synthetic peptide located within the following region: MGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGT |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BJ-TSA-9 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-FA83A antibody Titration: 1 ug/ml, Sample Type: Human 293T Whole Cell.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Human, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |