Cart summary

You have no items in your shopping cart.

FAM71D Rabbit Polyclonal Antibody (FITC)

FAM71D Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124234

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124234
CategoryAntibodies
DescriptionFAM71D Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FAM71D
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW46kDa
UniProt IDQ8N9W8
Protein SequenceSynthetic peptide located within the following region: VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN
NCBINP_775797
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC14orf54
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.