You have no items in your shopping cart.
FAM47E Rabbit Polyclonal Antibody
Description
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM47E |
| Target | FAM47E |
| Protein Sequence | Synthetic peptide located within the following region: RYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQSIFKKAMD |
| Molecular Weight | 38kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−FAM47E Rabbit Polyclonal Antibody (Biotin) [orb2084563]
WB
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlFAM47E Rabbit Polyclonal Antibody (FITC) [orb2084562]
WB
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001229868 |
|---|
Documents Download
Request a Document
FAM47E Rabbit Polyclonal Antibody (orb587829)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
