You have no items in your shopping cart.
FAM20A Antibody
SKU: orb1536465
Description
Images & Validation
−Item 1 of 1
| Tested Applications | IHC, IHC-P, WB |
|---|---|
| Dilution Range | IHC (1:100 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2). YREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMR |
| Target | FAM20A |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FAM20A, AIGFS, FP2747, Protein FAM20A
Similar Products
−- Item 1 of 1
Human Family with Sequence Similarity 20, Member A (FAM20A) ELISA Kit [orb777806]
Human
0.16-10 ng/mL
0.066 ng/mL
48 T, 96 T - Item 1 of 4
- Item 1 of 2
- Item 1 of 2
FA20A Rabbit Polyclonal Antibody [orb156812]
WB
Rabbit, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 3
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Western blot blot of extracts of various cells, using FAM20A antibody at 1:1000
Quick Database Links
Gene Symbol
FAM20A
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IHC-P
Immunohistochemistry Paraffin
FAM20A Antibody (orb1536465)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 2-3 weeks