Fam189b Rabbit Polyclonal Antibody

• Catalog Number: orb324517
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fam189b
• Target: Fam189b
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVP
• UniProt ID: Q5HZJ5
• MW: 72kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 1110013L07Rik antibody
• Research Area: Protein Biochemistry
• Note: For research use only
• NCBI: NP_001014995

Antibody Dilution: 1.0 ug/mL, Sample Type: Mouse Stomach.