FAM166B antibody

• Catalog Number: orb327171
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM166B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Human, Porcine
• Reactivity: Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAM166B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: FAM166B
• UniProt ID: A8MTA8
• Protein Sequence: Synthetic peptide located within the following region: QFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRKDTEKDQVPEPE
• NCBI: NP_001157782
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 293T tissue using FAM166B antibody